PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000098m
Common NameEUTSA_v10000098mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 606aa    MW: 66736.7 Da    PI: 6.5494
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000098mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.52.5e-27195248155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++Wt eLH++Fv av+qL G +kA Pk+il+lm+v+ Lt+e+v+SHLQk+Rl
  Thhalv10000098m 195 KPRVVWTVELHKKFVAAVNQL-GFDKAMPKRILDLMNVEKLTRENVASHLQKFRL 248
                      79*******************.********************************8 PP

2Response_reg84.53.2e-28191271109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ +++l+++l + +y +v+++ ++++alell+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++++++ + +  
  Thhalv10000098m  19 VLAVDDDQTCLRILETLLHRCQY-HVTTTNQAQKALELLRENKnmFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDPKYVMKGVTH 110
                      799********************.***************999999*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +eel +
  Thhalv10000098m 111 GACDYLLKPVRIEELKN 127
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.6E-1781605IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23009.4E-4316140No hitNo description
SuperFamilySSF521721.57E-3516137IPR011006CheY-like superfamily
SMARTSM004481.4E-3217129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.30318133IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.3E-2519127IPR001789Signal transduction response regulator, receiver domain
CDDcd001563.87E-2820132No hitNo description
PROSITE profilePS5129410.639192251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-29192253IPR009057Homeodomain-like
SuperFamilySSF466891.97E-19193252IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-24195248IPR006447Myb domain, plants
PfamPF002495.0E-7197246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 606 aa     Download sequence    Send to blast
MTVEQDFVAL DQFPVGMRVL AVDDDQTCLR ILETLLHRCQ YHVTTTNQAQ KALELLRENK  60
NMFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVTH GACDYLLKPV  120
RIEELKNIWQ HVVRSKGLDK NRGSNNGDKR DGLGNEVAAN SDQNNGRANR KRKDQYNEDE  180
EEERDDNDDS SAQKKPRVVW TVELHKKFVA AVNQLGFDKA MPKRILDLMN VEKLTRENVA  240
SHLQKFRLYL KRISGNQQAM MGHSDVHFLQ MSSSLGGLDG YHHRQIPVGT SQFHGGATAM  300
RSFPPNGILG RLNTPSGIGV RNLSSPPSGI FLLNQTDIGK FHHVSSLPLN HSDGGNILQG  360
LPMPLEFDQL QTNSNIRNMN NNNNNKSISG NSMAFPSFST QQSSLIGAPN NNLLVLEGHP  420
QASPQGFPGH QINKRLEHWS NAVSSSSTLP PPVQNSNNSI HHQFDVSPLP QHSKPDSLEW  480
NNGPTSYSIP FCDSATALSP GLDTNPRAFC RNIDFNSNAN AQPGGGFYDS LQMRQYGPNT  540
DAILSSNPKE GFIVGQQKLQ SGFLVAEAGS LDDIVNSTMK QEQSQGDLSG GDLGYGGFSS  600
LRTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-27191254164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405115.10.0hypothetical protein EUTSA_v10000098mg
SwissprotP625980.0ARR12_ARATH; Two-component response regulator ARR12
TrEMBLV4M2X00.0V4M2X0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__435__AT2G25180.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.10.0response regulator 12